- ZNRF1 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-84196
- 0.1 ml (also 25ul)
- Rabbit
- Unconjugated
- NIN283
- Human
- This antibody was developed against Recombinant Protein corresponding to amino acids: ASDSTYAHGN GYQETGGGHH RDGMLYLGSR ASLADALPLP IAPRWFSSHS GFKCPICSKS VASDEMEMHF I
- Immunohistochemistry, Immunohistochemistry-Paraffin
- PBS (pH 7.2) and 40% Glycerol
- ZNRF1
- zinc and ring finger 1
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Zinc Finger
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
ASDSTYAHGNGYQETGGGHHRDGMLYLGSRASLADALPLPIAPRWFSSHSGFKCPICSKSVASDEMEMHFI
Specifications/Features
Available conjugates: Unconjugated